Research Library · Compound Guide
TB-500 (Thymosin β4 Fragment): Research Overview & Molecular Profile
TB-500 is a synthetic peptide corresponding to an active region of the naturally occurring protein thymosin beta-4 (Tβ4). Thymosin β4 is a 43-amino-acid actin-binding protein, and the peptide segment often designated the actin-binding active site (the LKKTETQ region) is central to how it is studied. TB-500 is used in the research literature as a synthetic representation of this active region and is supplied as a lyophilized research powder for in vitro and animal-model study. At AurexBioLabs, TB-500 is supplied strictly as a research compound with third-party testing and a Certificate of Analysis on every batch.
For Research Use Only. Not for human or veterinary use. Not a drug, food, or cosmetic. This page is educational reference material for qualified researchers and contains no medical advice, dosing, or health claims.
TB-500 / Thymosin β4 Molecular Profile
| Related protein | Thymosin beta-4 (Tβ4), 43 amino acids |
|---|---|
| Full Tβ4 sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Active-site region | LKKTETQ (actin-binding region) |
| CAS number (synthetic TB-500 fragment) | 885340-08-9 |
| CAS number (full-length thymosin β4) | 77591-33-4 |
| Physical form | Lyophilized white powder |
Note: TB-500 is used commercially to refer to the synthetic thymosin β4 active-region peptide. Because product forms and hydration states vary, confirm the exact molecular weight and formula for your specific batch against its Certificate of Analysis.
Research Context
In preclinical research, thymosin β4 and its active-region fragment have been studied in cell-migration and tissue-model contexts, with the LKKTETQ region identified in the literature as central to actin binding. Published studies have examined its role in laboratory models of cellular differentiation and migration. TB-500 / thymosin β4 has not been approved by the FDA for any human or veterinary use. All referenced findings are confined to laboratory research; consult primary literature for methodology.
Handling & Laboratory Considerations
Storage
Lyophilized material stored frozen, protected from light.
Reconstitution (research context)
Bacteriostatic or sterile water per protocol; refrigerate the reconstituted solution.
Stability
Minimize freeze-thaw; protect from heat and light.
Quality & Verification at AurexBioLabs
Every batch of TB-500 is third-party HPLC and mass-spec verified with a published Certificate of Analysis. Verify your vial at our verification page.
Frequently Asked Questions
TB-500 is a synthetic peptide representing an active region of the thymosin β4 protein; the full protein is 43 amino acids.
The LKKTETQ region is described in the literature as the actin-binding active site.
The synthetic TB-500 fragment is commonly listed under CAS 885340-08-9; full-length thymosin β4 is 77591-33-4.
Molecular weight and formula can differ by product form and hydration state - always confirm against your batch's Certificate of Analysis.
Yes - HPLC and mass-spec verified with a COA per batch.
Next Steps
Verification & catalog
For Research Use Only. Not for human or veterinary use. Not a drug, food, or cosmetic. This page is educational reference material for qualified researchers and contains no medical advice, dosing, or health claims.
TB-500 is sold for laboratory research use only. Not for human or veterinary use, diagnostic, or therapeutic purposes.